Structure of PDB 7asm Chain K Binding Site BS02

Receptor Information
>7asm Chain K (length=137) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLLPKRVKYRRQHRPKTTGRSKGGNYVTFGEFGLQATTTSWITSRQIESA
RIAMTRYMKRGGKVWIKIFPHTPYTKKPLEVRMGAGKGAVEGWIAVVKPG
RILFEVAGVSEEVAREALRLASHKLPVKTKFVKREEL
Ligand information
>7asm Chain B (length=115) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucuggugacuauagcaaggaggucacaccuguucccaugccgaacacaga
aguuaagcuccuuagcgucgaugguagucgaacuuacguuccgcuagagu
agaacguugccaggc
<<<<<<<<<....<<<<<<<<.....<<<<<...............>>>.
.>>....>>>>>>.>>.<<......<<<.<<<<....>>>>.>>>.....
.>>..>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7asm Staphylococcus aureus 50S after 30 minutes incubation a 37C
Resolution2.48 Å
Binding residue
(original residue number in PDB)		T17 T39
Binding residue
(residue number reindexed from 1)		T17 T39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7asm, PDBe:7asm, PDBj:7asm
PDBsum7asm
PubMed
UniProtQ2FW13|RL16_STAA8 Large ribosomal subunit protein uL16 (Gene Name=rplP)

[Back to BioLiP]