Structure of PDB 7abg Chain K Binding Site BS02

Receptor Information
>7abg Chain K (length=123) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NDEEEYEAWKVRELKRIKRDREDREALEKEKAEIERMRNLTEEERRAELR
ANGKVITNKAVKGKYKFLQKYYHRGAFFMDEDEEVYKRDFSAPTLEDHFN
KTILPKVMQVKNFGRSGRTKYTH
Ligand information
>7abg Chain Z (length=47) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cuccgaacgguaagagccuagcauguagaaugaugucauacuuaucc
...............................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7abg Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
Resolution7.8 Å
Binding residue
(original residue number in PDB)		Y341 T389 K390
Binding residue
(residue number reindexed from 1)		Y71 T119 K120
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0001527 microfibril
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005813 centrosome
GO:0071005 U2-type precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7abg, PDBe:7abg, PDBj:7abg
PDBsum7abg
PubMed33243851
UniProtP55081|MFAP1_HUMAN Microfibrillar-associated protein 1 (Gene Name=MFAP1)

[Back to BioLiP]