Structure of PDB 6yhs Chain K Binding Site BS02

Receptor Information
>6yhs Chain K (length=115) Species: 575584 (Acinetobacter baumannii ATCC 19606 = CIP 70.34 = JCM 6841) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NEKKQSRLRRAKSTRLHIRALGATRLCVNRTPRHIYAQVISADGGKVLAQ
ASTLDASLRSGTTGNIEAATKVGALIAERAKAAGVTKVAFDRSGFKYHGR
IKALADAAREGGLEF
Ligand information
>6yhs Chain 5 (length=115) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcuggcgaccauagcaagagugaaccaccugaucccuucccgaacucaga
agugaaaccucuuagcgcugaugguagugugggauuacccaugugagagu
aagucaucgccagcu
<<<<<<<<.....<<<<<<<.....<<<<<<...............>>>.
.>>>....>>>>>.>><<<.......<<<<<<<....>>>>>>>......
.>>>..>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6yhs Structure of the 70S Ribosome from the Human Pathogen Acinetobacter baumannii in Complex with Clinically Relevant Antibiotics.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		N2 K4 R16 R20 R26 N30 R31 T32 P33 R34 H35 Y37 Q39 V48 Q51 R60 N66 I67 K97 H99 G100 R101
Binding residue
(residue number reindexed from 1)		N1 K3 R15 R19 R25 N29 R30 T31 P32 R33 H34 Y36 Q38 V47 Q50 R59 N65 I66 K96 H98 G99 R100
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6yhs, PDBe:6yhs, PDBj:6yhs
PDBsum6yhs
PubMed32857965
UniProtD0CD13

[Back to BioLiP]