Structure of PDB 6tb3 Chain K Binding Site BS02

Receptor Information
>6tb3 Chain K (length=82) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKKWSKKSMKDRAQHAVILDQEKYDRILKEVPTYRYVSVSVLVDRLKIGG
SLARIALRHLEKEGIIKPISKHSKQAIYTRAT
Ligand information
>6tb3 Chain n (length=75) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcgccguggcgcaguggaagcgcgcagggcucauaacccugauguccuc
ggaucgaaaccgagcggcgcuacca
<<<<<<<..<<<<.......>>>>.<<<<<.......>>>>>.....<<<
<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6tb3 The Ccr4-Not complex monitors the translating ribosome for codon optimality.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		K25 W27
Binding residue
(residue number reindexed from 1)		K2 W4
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6tb3, PDBe:6tb3, PDBj:6tb3
PDBsum6tb3
PubMed32299921
UniProtQ3E792|RS25A_YEAST Small ribosomal subunit protein eS25A (Gene Name=RPS25A)

[Back to BioLiP]