Structure of PDB 6qsz Chain K Binding Site BS02

Receptor Information
>6qsz Chain K (length=114) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LSKSSWRQEWLANLKLISVSLVDEFPSELSDSDRQIINEKMQLLKDIFAN
NLKSAISNNFRESDIIILKGEIEDYPMSSEIKIYYNELQNKKKARFWSFM
KTQRFVSNMGFDIQ
Ligand information
>6qsz Chain L (length=10) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
STDLPSDPPS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qsz The Sir4 H-BRCT domain interacts with phospho-proteins to sequester and repress yeast heterochromatin.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		L969 K971 W974 W978 R1066 W1068 K1072 N1079
Binding residue
(residue number reindexed from 1)		L1 K3 W6 W10 R95 W97 K101 N108
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6qsz, PDBe:6qsz, PDBj:6qsz
PDBsum6qsz
PubMed31515872
UniProtP11978|SIR4_YEAST Regulatory protein SIR4 (Gene Name=SIR4)

[Back to BioLiP]