Structure of PDB 6lbi Chain K Binding Site BS02

Receptor Information
>6lbi Chain K (length=80) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSA
GWKNSIRHNLSLHSKFIRVQNKSSWWMLNP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lbi Mechanism of forkhead transcription factors binding to a novel palindromic DNA site.
Resolution3.067 Å
Binding residue
(original residue number in PDB)		Y165 H215
Binding residue
(residue number reindexed from 1)		Y8 H58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6lbi, PDBe:6lbi, PDBj:6lbi
PDBsum6lbi
PubMed33577686
UniProtQ12778|FOXO1_HUMAN Forkhead box protein O1 (Gene Name=FOXO1)

[Back to BioLiP]