Structure of PDB 6l8e Chain K Binding Site BS02

Receptor Information
>6l8e Chain K (length=83) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MIIKNYSYARQNLKALMTKVNDDSDMVTVTSTDDKNVVIMSESDYNSMME
TLYLQQNPNNAEHLAQSIADLERGKTITKDIDV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6l8e Distinct oligomeric structures of the YoeB-YefM complex provide insights into the conditional cooperativity of type II toxin-antitoxin system.
Resolution2.35 Å
Binding residue
(original residue number in PDB)
Q11 K14
Binding residue
(residue number reindexed from 1)
Q11 K14
Enzymatic activity
Enzyme Commision number ?
External links