Structure of PDB 6bk8 Chain K Binding Site BS02

Receptor Information
>6bk8 Chain K (length=82) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYNGIGLKSAKGSSTSGHVQRSLASNNLAVQKQIETHMEKREIEVQVSEL
RDRLEEESEEQIDKKCEALRAKLTNEWQEQQR
Ligand information
>6bk8 Chain e (length=34) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuaauaaaaaaaguauauuuuuuuuuuuuuuau
..................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bk8 Structure of the yeast spliceosomal postcatalytic P complex.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		T16 S17 H19 V20
Binding residue
(residue number reindexed from 1)		T15 S16 H18 V19
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6bk8, PDBe:6bk8, PDBj:6bk8
PDBsum6bk8
PubMed29146870
UniProtQ03375|CWC21_YEAST Pre-mRNA-splicing factor CWC21 (Gene Name=CWC21)

[Back to BioLiP]