Structure of PDB 6az3 Chain K Binding Site BS02

Receptor Information
>6az3 Chain K (length=149) Species: 5661 (Leishmania donovani) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KSHYICAGRLVRILRGPRQDRVGVIVDIVDANRVLVENPEDAKMWRHVQN
LKNVEPLKYCVSVSRNCSAKALKDALASSKALEKYAKTRTAARVEAKKAC
AASTDFERYQLRVARRSRAHWARKVFDEKDAKTPVSWHKVALKKMQKKA
Ligand information
>6az3 Chain 6 (length=71) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aucgaaucgccaccuacaagacuggagcuugcucccucgaaggcgccaag
uauauucaugaucacaagaca
......<.<<<............<<<<....>>>>......>>>......
..................>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6az3 Atomic resolution snapshot of Leishmania ribosome inhibition by the aminoglycoside paromomycin.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y64 C66 R69 K118 T148 R149 T150 R153 K157 R172 V173 R176 H180 W181 R183 W197
Binding residue
(residue number reindexed from 1)		Y4 C6 R9 K58 T88 R89 T90 R93 K97 R112 V113 R116 H120 W121 R123 W137
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6az3, PDBe:6az3, PDBj:6az3
PDBsum6az3
PubMed29150609
UniProtQ25278|RL14_LEIDO Large ribosomal subunit protein eL14 (Gene Name=RPL14)

[Back to BioLiP]