Structure of PDB 6ama Chain K Binding Site BS02

Receptor Information
>6ama Chain K (length=54) Species: 54571 (Streptomyces venezuelae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EPLLTPAEVATMFRVDPKTVTRWAKAGKLTSIRTLGGHRRYREAEVRALL
AGIP
Ligand information
>6ama Chain R (length=99) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
attcgggtaattcgggtaattcgggtaattcgggtaattcgggtaattcg
ggtaattcgggtaattcgggtaattcgggtaattcgggtaattcgggta
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ama The MerR-like protein BldC binds DNA direct repeats as cooperative multimers to regulate Streptomyces development.
Resolution3.09 Å
Binding residue
(original residue number in PDB)		P14 A15 K26 T29 H46 R47
Binding residue
(residue number reindexed from 1)		P6 A7 K18 T21 H38 R39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6ama, PDBe:6ama, PDBj:6ama
PDBsum6ama
PubMed29556010
UniProtF2REK9

[Back to BioLiP]