Structure of PDB 6ah3 Chain K Binding Site BS02

Receptor Information
>6ah3 Chain K (length=128) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NGTLLVPPPRTIANQDHFHRLNYLYQISAYQTRARQKARTDAHTPLARNY
IKSMDLISKKTKTSLLPTIKRTICKKCHRLLWTPKKLEITSDGALSVMCG
CGTVKRFNIGADPNYRTYSEREGNLLNS
Ligand information
>6ah3 Chain T (length=80) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agaagcggauuuagcucaguugggagagcgccagacugaagaucuggagg
uccuguguucgauccacagaauucgcauuu
....<<<<<<<..<<<<........>>>>.<<<<<.......>>>>>...
..<<<<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ah3 Structural insight into precursor tRNA processing by yeast ribonuclease P.
Resolution3.48 Å
Binding residue
(original residue number in PDB)
K75 K76 K78
Binding residue
(residue number reindexed from 1)
K59 K60 K62
Enzymatic activity
Enzyme Commision number 3.1.26.5: ribonuclease P.
Gene Ontology
Molecular Function
GO:0004526 ribonuclease P activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016787 hydrolase activity
GO:0046872 metal ion binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006396 RNA processing
GO:0008033 tRNA processing
GO:0034965 intronic box C/D snoRNA processing
Cellular Component
GO:0005634 nucleus
GO:0005655 nucleolar ribonuclease P complex
GO:1902555 endoribonuclease complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6ah3, PDBe:6ah3, PDBj:6ah3
PDBsum6ah3
PubMed30262633
UniProtP40571|RPR2_YEAST Ribonuclease P protein subunit RPR2 (Gene Name=RPR2)

[Back to BioLiP]