Structure of PDB 5n89 Chain K Binding Site BS02

Receptor Information
>5n89 Chain K (length=119) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPA
TDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTT
EANAWKSTLVGHDTFTKVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5n89 Stepwise Evolution Improves Identification of Diverse Peptides Binding to a Protein Target.
Resolution1.27 Å
Binding residue
(original residue number in PDB)
A117 W120
Binding residue
(residue number reindexed from 1)
A102 W105
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:5n89, PDBe:5n89, PDBj:5n89
PDBsum5n89
PubMed28935886
UniProtP22629|SAV_STRAV Streptavidin

[Back to BioLiP]