Structure of PDB 5mmi Chain K Binding Site BS02

Receptor Information

>5mmi Chain K (length=203) Species: 3562 (Spinacia oleracea) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RKSTSASTKCTEEWRQLKEAVKKEFAIPHVPLDQRWMFTLEEATGPDIWN
TTWYPKSADHVPTDKKWYVVDATDLILGRMASTIAIHIRGKNLASYTPSV
DMGAFVIVVNADKVAVSGKKRTQKLYRRHSGRPGGLKEETFDQLQKRIPE
RIIEHAVRGMLPKGRLGRYLFNHLKVYKGAEHPHQAQQPIDLPLRDKRIR
VEK

Ligand information

>5mmi Chain W (length=106) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

agagaaggucacggcgagacgagccguuuaucauuacgauaggugucaag
uggaagugcagugauguaugcagcugaggcauccuaacagacccacagac
uugaac

......<<<<<<<<<.......>>>>>............<<<<<<<<.<<
<....<<<<<....>>>>>...>>>..>>>>>.>>>...>>>>.......
......

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5mmi The complete structure of the chloroplast 70S ribosome in complex with translation factor pY.
Resolution	3.2 Å
Binding residue (original residue number in PDB)	R48 K49 S50 T51 S52 T110 A233
Binding residue (residue number reindexed from 1)	R1 K2 S3 T4 S5 T63 A186

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0017148	negative regulation of translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0009507	chloroplast
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5mmi, PDBe:5mmi, PDBj:5mmi
PDBsum	5mmi
PubMed	28007896
UniProt	P12629\|RK13_SPIOL Large ribosomal subunit protein uL13c (Gene Name=RPL13)

[Back to BioLiP]