Structure of PDB 5lux Chain K Binding Site BS02

Receptor Information
>5lux Chain K (length=63) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWF
QNRRAKERKVNKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5lux Impact of cytosine methylation on DNA binding specificities of human transcription factors.
Resolution3.23 Å
Binding residue
(original residue number in PDB)
Y157 R158 V160 Y178 K199 Q203 R206 R210
Binding residue
(residue number reindexed from 1)
Y5 R6 V8 Y26 K47 Q51 R54 R58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:5lux, PDBe:5lux, PDBj:5lux
PDBsum5lux
PubMed28473536
UniProtP47902|CDX1_HUMAN Homeobox protein CDX-1 (Gene Name=CDX1)

[Back to BioLiP]