Structure of PDB 5lty Chain K Binding Site BS02

Receptor Information
>5lty Chain K (length=71) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWF
QNRRAKERKINKKKLQQQQQQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5lty Impact of cytosine methylation on DNA binding specificities of human transcription factors.
Resolution2.66 Å
Binding residue
(original residue number in PDB)		Y189 R190 V192 Q235 R238 R242
Binding residue
(residue number reindexed from 1)		Y5 R6 V8 Q51 R54 R58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5lty, PDBe:5lty, PDBj:5lty
PDBsum5lty
PubMed28473536
UniProtQ99626|CDX2_HUMAN Homeobox protein CDX-2 (Gene Name=CDX2)

[Back to BioLiP]