Structure of PDB 2wwb Chain K Binding Site BS02

Receptor Information
>2wwb Chain K (length=83) Species: 4565 (Triticum aestivum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LDSYKVIEQPITSETAMKKVEDGNILVFQVSMKANKYQIKKAVKELYEVD
VLKVNTLVRPNGTKKAYVRLTADYDALDIANRI
Ligand information
>2wwb Chain F (length=25) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccacgucaacagcaguuggacgugg
<<<<<<...<<.....>>.>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wwb Structure of Monomeric Yeast and Mammalian Sec61 Complexes Interacting with the Translating Ribosome.
Resolution6.48 Å
Binding residue
(original residue number in PDB)		E70 R115
Binding residue
(residue number reindexed from 1)		E14 R59
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2wwb, PDBe:2wwb, PDBj:2wwb
PDBsum2wwb
PubMed19933108
UniProtP04456|RL25_YEAST Large ribosomal subunit protein uL23 (Gene Name=RPL25)

[Back to BioLiP]