Structure of PDB 2f8n Chain K Binding Site BS02

Receptor Information
>2f8n Chain K (length=105) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEIL
ELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQA
VLLPK
Ligand information
>2f8n Chain J (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagcggattccgctgaacatgccttttgatggagc
agtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2f8n Nucleosomes containing the histone domain of macroH2A: In vitro possibilities.
Resolution2.9 Å
Binding residue
(original residue number in PDB)
R29 R35 R42 G44 A45 T76 R77
Binding residue
(residue number reindexed from 1)
R16 R22 R29 G31 A32 T63 R64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:2f8n, PDBe:2f8n, PDBj:2f8n
PDBsum2f8n
PubMed
UniProtQ8CGP6|H2A1H_MOUSE Histone H2A type 1-H (Gene Name=H2ac12)

[Back to BioLiP]