Structure of PDB 1is7 Chain K Binding Site BS02

Receptor Information
>1is7 Chain K (length=84) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MPYLLISTQIRMEVGPTMVGDEHSDPELMQQLGASKRRVLGNNFYEYYVN
DPPRIVLDKLECRGFRVLSMTGVGQTLVWCLHKE
Ligand information
Ligand IDPHE
InChIInChI=1S/C9H11NO2/c10-8(9(11)12)6-7-4-2-1-3-5-7/h1-5,8H,6,10H2,(H,11,12)/t8-/m0/s1
InChIKeyCOLNVLDHVKWLRT-QMMMGPOBSA-N
SMILES
SoftwareSMILES
CACTVS 3.341N[CH](Cc1ccccc1)C(O)=O
CACTVS 3.341N[C@@H](Cc1ccccc1)C(O)=O
OpenEye OEToolkits 1.5.0c1ccc(cc1)CC(C(=O)O)N
OpenEye OEToolkits 1.5.0c1ccc(cc1)C[C@@H](C(=O)O)N
ACDLabs 10.04O=C(O)C(N)Cc1ccccc1
FormulaC9 H11 N O2
NamePHENYLALANINE
ChEMBLCHEMBL301523
DrugBankDB00120
ZINCZINC000000105196
PDB chain1is7 Chain O Residue 1008 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1is7 Crystal structure of the stimulatory complex of GTP cyclohydrolase I and its feedback regulatory protein GFRP.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		V73 G74 Q75 T76
Binding residue
(residue number reindexed from 1)		V73 G74 Q75 T76
Annotation score4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004857 enzyme inhibitor activity
GO:0005515 protein binding
GO:0016597 amino acid binding
GO:0019899 enzyme binding
GO:0030742 GTP-dependent protein binding
GO:0042802 identical protein binding
GO:0044549 GTP cyclohydrolase binding
GO:0044877 protein-containing complex binding
Biological Process
GO:0009890 negative regulation of biosynthetic process
GO:0045428 regulation of nitric oxide biosynthetic process
GO:0065003 protein-containing complex assembly
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016020 membrane
GO:0030425 dendrite
GO:0031965 nuclear membrane
GO:0032991 protein-containing complex
GO:0042470 melanosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1is7, PDBe:1is7, PDBj:1is7
PDBsum1is7
PubMed11818540
UniProtP70552|GFRP_RAT GTP cyclohydrolase 1 feedback regulatory protein (Gene Name=Gchfr)

[Back to BioLiP]