Structure of PDB 8hfr Chain Jy Binding Site BS02

Receptor Information
>8hfr Chain Jy (length=166) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVRTF
GIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFGID
EHIDLGIKYDPSIGIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTTKE
DTVSWFKQKYDADVLD
Ligand information
>8hfr Chain 2f (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hfr Nuclear export of pre-60S particles through the nuclear pore complex.
Resolution2.64 Å
Binding residue
(original residue number in PDB)		M9 T44 V46 T70 R72 G135 R137 V138 R141 R143 T147 G149 N150 H152
Binding residue
(residue number reindexed from 1)		M2 T37 V39 T63 R65 G128 R130 V131 R134 R136 T140 G142 N143 H145
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hfr, PDBe:8hfr, PDBj:8hfr
PDBsum8hfr
PubMed37258668
UniProtP0C0W9|RL11A_YEAST Large ribosomal subunit protein uL5A (Gene Name=RPL11A)

[Back to BioLiP]