Structure of PDB 6zqg Chain JL Binding Site BS02

Receptor Information
>6zqg Chain JL (length=283) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QHILKNPLVAQGIVDKAQIRPSDVVLEVGPGTGNLTVRILEQAKNVVAVE
MDPRMAAELTKRVRGTPVEKKLEIMLGDFMKTELPYFDICISNTPYQISS
PLVFKLINQPRPPRVSILMFQREFALRLLARPGDSLYCRLSANVQMWANV
THIMKVGKNNFRPPPQVESSVVRLEIKNPRPQVDYNEWDGLLRIVFVRKN
RTISAGFKSTTVMDILEKNYKTFLAMNNEMVDDTKGSMHDVVKEKIDTVL
KETDLGDKRAGKCDQNDFLRLLYAFHQVGIHFS
Ligand information
>6zqg Chain D4 (length=23) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggucgacguacuucauaggauca
.......................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zqg 90 S pre-ribosome transformation into the primordial 40 S subunit.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		K51 H187 M189 K190 R208
Binding residue
(residue number reindexed from 1)		K16 H152 M154 K155 R173
Enzymatic activity
Enzyme Commision number 2.1.1.183: 18S rRNA (adenine(1779)-N(6)/adenine(1780)-N(6))-dimethyltransferase.
Gene Ontology
Molecular Function
GO:0000179 rRNA (adenine-N6,N6-)-dimethyltransferase activity
GO:0003723 RNA binding
GO:0008168 methyltransferase activity
GO:0052909 18S rRNA (adenine(1779)-N(6)/adenine(1780)-N(6))-dimethyltransferase activity
Biological Process
GO:0000154 rRNA modification
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0031167 rRNA methylation
GO:0032259 methylation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0030686 90S preribosome
GO:0030688 preribosome, small subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zqg, PDBe:6zqg, PDBj:6zqg
PDBsum6zqg
PubMed32943521
UniProtP41819|DIM1_YEAST Dimethyladenosine transferase (Gene Name=DIM1)

[Back to BioLiP]