Structure of PDB 8p2g Chain J Binding Site BS02

Receptor Information

>8p2g Chain J (length=176) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NRLKEKFNTEVTENLMKKFNYSSVMEVPKIDKIVVNMGVGDAVQNSKVLD
NAVEELELITGQKPLVTKAKKSIATFRLREGMPIGAKVTLRGERMYEFLD
KLISVSLPRVRDFQGVSKKAFDGRGNYTLGVKEQLIFPEIDYDKVSKVRG
MDIVIVTTANTDEEARELLANFGMPF

Ligand information

>8p2g Chain B (length=113) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cuggugacuauagcaaggaggucacaccuguucccaugccgaacacagaa
guuaagcuccuuagcgucgaugguagucgaacuuacguuccgcuagagua
gaacguugccagg

<<<<<<<<....<<<<<<<<.....<<<<<...............>>>..
>>....>>>>>>.>>.<<......<<<.<<<<....>>>>.>>>......
>>..>>>>>>>>.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8p2g Cryo-EM structures of Staphylococcus aureus 70S ribosomes in complex with elongation factor G and fusidic acid
Resolution	2.02 Å
Binding residue (original residue number in PDB)	S24 M26 E27 Q63 K64 L66 K69 T90 R92
Binding residue (residue number reindexed from 1)	S23 M25 E26 Q62 K63 L65 K68 T89 R91

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8p2g, PDBe:8p2g, PDBj:8p2g
PDBsum	8p2g
PubMed	38902339
UniProt	Q2FW18\|RL5_STAA8 Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]