Structure of PDB 8cef Chain J Binding Site BS02

Receptor Information

>8cef Chain J (length=88) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNECEIT
KRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYK

Ligand information

>8cef Chain B (length=26) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tcgtaaaggtcacggtgaccttgaca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8cef Asymmetric dimerization in a transcription factor superfamily is promoted by allosteric interactions with DNA.
Resolution	2.486 Å
Binding residue (original residue number in PDB)	G88 Y89 H90 Y91 K100 K104 K129 V149 R150 R153 V154 R155 R158 Y161
Binding residue (residue number reindexed from 1)	G14 Y15 H16 Y17 K26 K30 K55 V75 R76 R79 V80 R81 R84 Y87

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0008270	zinc ion binding
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:8cef, PDBe:8cef, PDBj:8cef
PDBsum	8cef
PubMed	37503845
UniProt	O08580\|ERR1_MOUSE Steroid hormone receptor ERR1 (Gene Name=Esrra)

[Back to BioLiP]