Structure of PDB 7v9g Chain J Binding Site BS02

Receptor Information
>7v9g Chain J (length=99) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VPSPYLLSDKEVREIVQQSLSVGNFAARLLVRLFPELFTTENLRLQYNHS
GACNKKQLDPTRLRLIRHYVEAVYPVEKMEEVWHYECIPSIDERCRRPN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7v9g Highly enriched BEND3 prevents the premature activation of bivalent genes during differentiation.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		H795 R807
Binding residue
(residue number reindexed from 1)		H84 R96
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000183 rDNA heterochromatin formation
Cellular Component
GO:0000792 heterochromatin

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7v9g, PDBe:7v9g, PDBj:7v9g
PDBsum7v9g
PubMed35143257
UniProtQ6PAL0|BEND3_MOUSE BEN domain-containing protein 3 (Gene Name=Bend3)

[Back to BioLiP]