Structure of PDB 7tax Chain J Binding Site BS02

Receptor Information
>7tax Chain J (length=228) Species: 286 (Pseudomonas) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNAIHIGPFSITPAARGLHYGGLPHHQWTLYYGPREMAIKTLPDSYTSSE
VRDEFSDIIAEFVIDARHRYAPDVLELVNSDGDAVLARVAVSRLPEALSG
CIPDDRFPYWLLTASRPRLGLPVTLNEYTALAVELSAPPLAWITGLLPGE
VLTHDAEEWRPPTSWELRHVVGEGSFTGVSGAAAAALLGMSATNFRKYTA
GDSAANRQKISFAAWHYLLDRLGVKRAS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7tax Structural basis of AcrIF24 as an anti-CRISPR protein and transcriptional suppressor.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		G172 E173 S180 R196 A200 G201 A204 A205 N206
Binding residue
(residue number reindexed from 1)		G172 E173 S180 R196 A200 G201 A204 A205 N206
External links