Structure of PDB 7psx Chain J Binding Site BS02

Receptor Information
>7psx Chain J (length=58) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNR
RVKEKKVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7psx Structure of HOXB13 bound to hydroxymethylated DNA
Resolution2.0 Å
Binding residue
(original residue number in PDB)		R220 P222 F240 K243 R246 Q265 R268 K272
Binding residue
(residue number reindexed from 1)		R3 P5 F23 K26 R29 Q48 R51 K55
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7psx, PDBe:7psx, PDBj:7psx
PDBsum7psx
PubMed
UniProtQ92826|HXB13_HUMAN Homeobox protein Hox-B13 (Gene Name=HOXB13)

[Back to BioLiP]