Structure of PDB 7nhn Chain J Binding Site BS02

Receptor Information
>7nhn Chain J (length=175) Species: 169963 (Listeria monocytogenes EGD-e) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NRLKDQYLKEIVPALMSKFNYDSVMEVPKIDKIVINTGVGDATANAKVLD
SAVEELALITGQKPVITKAKNSIAGFRLREGMPIGAKVTLRGERMYDFLD
KLVTVSLPRVRDFRGVSKKAFDGRGNYTLGVREQLIFPEIDYDQVSKVRG
MDVVIVTTAKSDEESHELLTQLGMP
Ligand information
>7nhn Chain B (length=114) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cugguaguuauggcgagaaggucacacccguucccaucccgaacacggua
guuaagcuucucugcgccaaugguaguugggggcuucccccugcgagagu
aggucgcugccggg
<<<<<<<<....<<<<<<<<.....<<<<<...............>>>..
>>....>>>>>>.>><<<.......<<.<<<<<...>>>>>.>>......
.>>>.>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nhn Structural basis of ABCF-mediated resistance to pleuromutilin, lincosamide, and streptogramin A antibiotics in Gram-positive pathogens.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		S24 M26 E27 Q63 K64 V66 I67 K69 V89 T90 R92
Binding residue
(residue number reindexed from 1)		S23 M25 E26 Q62 K63 V65 I66 K68 V88 T89 R91
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nhn, PDBe:7nhn, PDBj:7nhn
PDBsum7nhn
PubMed34117249
UniProtQ927L9|RL5_LISMO Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]