Structure of PDB 7et4 Chain J Binding Site BS02

Receptor Information
>7et4 Chain J (length=101) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAASSYDIAVRRF
RGRDAVTNFKSQVDGNDAESAFLDAHSKAEIVDMLRKHTYADEFEQSRRK
F
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7et4 TEM1 combinatorially binds to FLOWERING LOCUS T and recruits a Polycomb factor to repress the floral transition in Arabidopsis.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		Q78 P79 N80 R82 R93 W95 T98 R152
Binding residue
(residue number reindexed from 1)		Q12 P13 N14 R16 R27 W29 T32 R86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7et4, PDBe:7et4, PDBj:7et4
PDBsum7et4
PubMed34446554
UniProtQ9C6M5|RAVL1_ARATH AP2/ERF and B3 domain-containing transcription repressor TEM1 (Gene Name=TEM1)

[Back to BioLiP]