Structure of PDB 7bzg Chain J Binding Site BS02

Receptor Information
>7bzg Chain J (length=110) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRMDDKRFNCEKELTLAVIGGKWKMLILWHLGKEGTKRFNELKTLIPDIT
QKILVNQLRELEQDMIVHREVYPVVPPKVEYSLTPHGESLMPILEAMYEW
GKGYMELIDI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7bzg Genetically encoded formaldehyde sensors inspired by a protein intra-helical crosslinking reaction.
Resolution2.9 Å
Binding residue
(original residue number in PDB)
R39 F40 N41 Q52 K53 R60 P78 V80 Y82
Binding residue
(residue number reindexed from 1)
R38 F39 N40 Q51 K52 R59 P77 V79 Y81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:7bzg, PDBe:7bzg, PDBj:7bzg
PDBsum7bzg
PubMed33495458
UniProtP42406|HXLR_BACSU HTH-type transcriptional activator HxlR (Gene Name=hxlR)

[Back to BioLiP]