Structure of PDB 7a0r Chain J Binding Site BS02

Receptor Information
>7a0r Chain J (length=136) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRTKFRKQFRGRMTGDAKGGDYVAFGDYGLIAMEPAWIKSNQIEACRIVM
SRHFRRGGKIYIRIFPDKPVTKKPAETRMGKGKGAVEYWVSVVKPGRVMF
EVAGVTEEQAKEAFRLAGHKLPIQTKMVKREVYDEA
Ligand information
>7a0r Chain Y (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acccccgugcccauagcacuguggaaccaccccaccccaugccgaacugg
gucgugaaacacagcagcgccaaugauacucggaccgcagggucccggaa
aagucggucagcgcgggggu
<<<<<<<<<<.....<<.<<<<<....<<<<<<<.............>>>
>..>>>...>>>>>..>><<<.......<<.<<<<<....>>>>>.>>..
.....>>>..>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7a0r Ribosome-binding and anti-microbial studies of the mycinamicins, 16-membered macrolide antibiotics from Micromonospora griseorubida.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		M18 T19 E39 P40 K99
Binding residue
(residue number reindexed from 1)		M13 T14 E34 P35 K94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7a0r, PDBe:7a0r, PDBj:7a0r
PDBsum7a0r
PubMed34417608
UniProtQ9RXJ5|RL16_DEIRA Large ribosomal subunit protein uL16 (Gene Name=rplP)

[Back to BioLiP]