Structure of PDB 6tc2 Chain J Binding Site BS02

Receptor Information
>6tc2 Chain J (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Ligand information
>6tc2 Chain F (length=26) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QHLCGSHLVEALYLVCGERGFFYTPK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6tc2 Insulin polymorphism induced by two polyphenols: new crystal forms and advances in macromolecular powder diffraction.
Resolution1.36 Å
Binding residue
(original residue number in PDB)
S9 H10
Binding residue
(residue number reindexed from 1)
S9 H10
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:6tc2, PDBe:6tc2, PDBj:6tc2
PDBsum6tc2
PubMed33135678
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]