Structure of PDB 6n8j Chain J Binding Site BS02

Receptor Information
>6n8j Chain J (length=161) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NPMRDLKIEKLVLNISVGRLTRASKVLEQLSGQTPVQSKARYTVRTFGIR
RNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFGIDEHI
DLGIKYDPSIGIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTTKEDTV
SWFKQKYDADV
Ligand information
>6n8j Chain 2 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<......<...>...>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6n8j Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		M9 R10 Q43 T44 V69 T70 R72 P134 G135 R137 R141 R143 G149 N150 H152
Binding residue
(residue number reindexed from 1)		M3 R4 Q33 T34 V59 T60 R62 P124 G125 R127 R131 R133 G139 N140 H142
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6n8j, PDBe:6n8j, PDBj:6n8j
PDBsum6n8j
PubMed30814529
UniProtP0C0W9|RL11A_YEAST Large ribosomal subunit protein uL5A (Gene Name=RPL11A)

[Back to BioLiP]