Structure of PDB 6lc1 Chain J Binding Site BS02

Receptor Information
>6lc1 Chain J (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKR
RRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lc1 Structural basis of NR4A1 bound to the human pituitary proopiomelanocortin gene promoter.
Resolution3.12 Å
Binding residue
(original residue number in PDB)		R293 R316 N317 Q320 R323 R346 G347 R348
Binding residue
(residue number reindexed from 1)		R29 R52 N53 Q56 R59 R82 G83 R84
Binding affinityPDBbind-CN: Kd=135.33nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6lc1, PDBe:6lc1, PDBj:6lc1
PDBsum6lc1
PubMed31822342
UniProtP22736|NR4A1_HUMAN Nuclear receptor subfamily 4immunitygroup A member 1 (Gene Name=NR4A1)

[Back to BioLiP]