Structure of PDB 6jrp Chain J Binding Site BS02

Receptor Information
>6jrp Chain J (length=74) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HIRRPMNAFMIFSKRHRALVHQRHPNQDNRTVSKILGEWWYALGPKEKQK
YHDLAFQVKEAHFKAHPDWKWCNK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jrp The crystal structure of Capicua HMG-box domain complexed with the ETV5-DNA and its implications for Capicua-mediated cancers.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R201 R202 M204 M208 K212 D226 N227 N271 K272
Binding residue
(residue number reindexed from 1)		R3 R4 M6 M10 K14 D28 N29 N73 K74
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6jrp, PDBe:6jrp, PDBj:6jrp
PDBsum6jrp
PubMed31323153
UniProtQ96RK0|CIC_HUMAN Protein capicua homolog (Gene Name=CIC)

[Back to BioLiP]