Structure of PDB 6hb4 Chain J Binding Site BS02

Receptor Information
>6hb4 Chain J (length=193) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPD
SKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAM
TKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLS
DSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6hb4 DNA specificities modulate the binding of human transcription factor A to mitochondrial DNA control region.
Resolution3.05 Å
Binding residue
(original residue number in PDB)
K51 K52 V54 L58 K62 K69 K139 M143 R157 Y162 Q179 L182 K183 K186 W189 Y211 R232
Binding residue
(residue number reindexed from 1)
K8 K9 V11 L15 K19 K26 K96 M100 R114 Y119 Q136 L139 K140 K143 W146 Y168 R189
Binding affinityPDBbind-CN: Kd=4.4nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6hb4, PDBe:6hb4, PDBj:6hb4
PDBsum6hb4
PubMed31114891
UniProtQ00059|TFAM_HUMAN Transcription factor A, mitochondrial (Gene Name=TFAM)

[Back to BioLiP]