Structure of PDB 6ah3 Chain J Binding Site BS02

Receptor Information
>6ah3 Chain J (length=293) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLVDLNVPWPQNSYADKVTSQAVNNLIKTLSTLHMLGYTHIAINFTVNHS
EKFPNDVKLLNPIDIKRRFGELMDRTGLKLYSRITLIIDDPSKGQSLSKI
SQAFDIVAALPISEKGLTLSTTNLDIDLLTFQYGSRLPTFLKHKSICSCV
NRGVKLEIVYGYALRDVQARRQFVSNVRSVIRSSRSRGIVIGSGAMSPLE
CRNILGVTSLIKNLGLPSDRCSKAMGDLASLVLLNGRLRNKSHKQTIVTG
GGSGNGDDVVNDVQGIDDVQTIKVVKRSMDAEQLGHASKRHKP
Ligand information
>6ah3 Chain T (length=80) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agaagcggauuuagcucaguugggagagcgccagacugaagaucuggagg
uccuguguucgauccacagaauucgcauuu
....<<<<<<<..<<<<........>>>>.<<<<<.......>>>>>...
..<<<<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ah3 Structural insight into precursor tRNA processing by yeast ribonuclease P.
Resolution3.48 Å
Binding residue
(original residue number in PDB)		P91 K93 G94 F140 K142 K144 S145 S148 K244
Binding residue
(residue number reindexed from 1)		P91 K93 G94 F140 K142 K144 S145 S148 K244
Enzymatic activity
Enzyme Commision number 3.1.26.5: ribonuclease P.
Gene Ontology
Molecular Function
GO:0000171 ribonuclease MRP activity
GO:0003723 RNA binding
GO:0004526 ribonuclease P activity
GO:0005515 protein binding
GO:0016787 hydrolase activity
Biological Process
GO:0000294 nuclear-transcribed mRNA catabolic process, RNase MRP-dependent
GO:0000460 maturation of 5.8S rRNA
GO:0001682 tRNA 5'-leader removal
GO:0006364 rRNA processing
GO:0008033 tRNA processing
GO:0034965 intronic box C/D snoRNA processing
Cellular Component
GO:0000172 ribonuclease MRP complex
GO:0005634 nucleus
GO:0005655 nucleolar ribonuclease P complex
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ah3, PDBe:6ah3, PDBj:6ah3
PDBsum6ah3
PubMed30262633
UniProtP38786|RPP1_YEAST Ribonuclease P/MRP protein subunit RPP1 (Gene Name=RPP1)

[Back to BioLiP]