Structure of PDB 5yef Chain J Binding Site BS02

Receptor Information
>5yef Chain J (length=167) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHKCPDCDMAFVGELVRHRRYKHTHEKPFKCSMCDYASVEVSKLKRHIRS
HTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSGTM
KMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYC
DAVFHERYALIQHQKSH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yef Molecular mechanism of directional CTCF recognition of a diverse range of genomic sites
Resolution2.807 Å
Binding residue
(original residue number in PDB)		R339 H340 Y343 K344 E362 K365 R368 H369 S372 R377 Y386 R389 K393 R396 H397 T400 K405 F416 Q418 T421 H425 K429 I446 R448 D451 H455 R479
Binding residue
(residue number reindexed from 1)		R17 H18 Y21 K22 E40 K43 R46 H47 S50 R55 Y64 R67 K71 R74 H75 T78 K83 F94 Q96 T99 H103 K107 I124 R126 D129 H133 R157
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5yef, PDBe:5yef, PDBj:5yef
PDBsum5yef
PubMed29076501
UniProtP49711|CTCF_HUMAN Transcriptional repressor CTCF (Gene Name=CTCF)

[Back to BioLiP]