Structure of PDB 5xxb Chain J Binding Site BS02

Receptor Information
>5xxb Chain J (length=166) Species: 5811 (Toxoplasma gondii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENPMRKIRIEKLTLNICVGESGDRLTRAARVLEQLTGQRPQFSKARFTIR
SFGIRRNEKIACYVTVRGKKAEDILEKGLKVKEYELKKKNFSDSGNFGFG
IQEHIDLGIKYDPSTGIYGMDFYVQLTRPGNRVAHRKRARGRVGHSHRVT
KEDSIKWFQQTYDGIV
Ligand information
>5xxb Chain 3 (length=118) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcugucggucauacugcgucgaauacaccggaucccuucagaccuccgaa
uuaagcggcgcaaggcccgguuaguacuugggugggggacucccagggaa
uaccgggugcugacagcu
<<<<<<<<.....<<<<<<<<.....<.<<<..............>>>..
>....>>>>>>.>><<<<<<<.....<<<<<<.<<....>>>>>>>>...
.>>>>>>>.>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xxb Cryo-EM structures of the 80S ribosomes from human parasites Trichomonas vaginalis and Toxoplasma gondii
Resolution3.17 Å
Binding residue
(original residue number in PDB)		E7 M10 Q44 R45 Q47 V70 T71 R73 G136 R138 R142 R148 V149 H151 H153
Binding residue
(residue number reindexed from 1)		E1 M4 Q38 R39 Q41 V64 T65 R67 G130 R132 R136 R142 V143 H145 H147
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 23:57:09 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '5xxb', asym_id = 'J', bs = 'BS02', title = 'Cryo-EM structures of the 80S ribosomes from hum...sites Trichomonas vaginalis and Toxoplasma gondii'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='5xxb', asym_id='J', bs='BS02', title='Cryo-EM structures of the 80S ribosomes from hum...sites Trichomonas vaginalis and Toxoplasma gondii')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '5xxb', asym_id = 'J'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='5xxb', asym_id='J')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>