Structure of PDB 5hkv Chain J Binding Site BS02

Receptor Information
>5hkv Chain J (length=137) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LLPKRVKYRRQHRPKTTGRSKGGNYVTFGEFGLQATTTSWITSRQIESAR
IAMTRYMKRGGKVWIKIFPHTPYTKKPLEVRMGAGKGAVEGWIAVVKPGR
ILFEVAGVSEEVAREALRLASHKLPVKTKFVKREELG
Ligand information
>5hkv Chain Y (length=114) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucuggugacuauagcaaggaggucacaccuguucccaugccgaacacaga
aguuaaggucuuuagcgacgaugguagccaacuuacguuccgcuagagua
gaacguugccaggc
.<<.<..<.....<<<<<<<......<<<<<...............>>>.
.>>.....>>>>>.>><....<<...<.<............>.>....>>
...>..>..>.>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5hkv Structural insights of lincosamides targeting the ribosome of Staphylococcus aureus.
Resolution3.66 Å
Binding residue
(original residue number in PDB)		R20 T39
Binding residue
(residue number reindexed from 1)		R19 T38
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5hkv, PDBe:5hkv, PDBj:5hkv
PDBsum5hkv
PubMed28973455
UniProtQ2FW13|RL16_STAA8 Large ribosomal subunit protein uL16 (Gene Name=rplP)

[Back to BioLiP]