Structure of PDB 5eea Chain J Binding Site BS02

Receptor Information

>5eea Chain J (length=61) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQN
RRVKEKKVLAK

Ligand information

>5eea Chain L (length=18) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggacccaataaaacacaa

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5eea Two distinct DNA sequences recognized by transcription factors represent enthalpy and entropy optima.
Resolution	2.195 Å
Binding residue (original residue number in PDB)	R220 K243 R246 Q265 R268
Binding residue (residue number reindexed from 1)	R4 K27 R30 Q49 R52
Binding affinity	PDBbind-CN: Kd=41nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5eea, PDBe:5eea, PDBj:5eea
PDBsum	5eea
PubMed	29638214
UniProt	Q92826\|HXB13_HUMAN Homeobox protein Hox-B13 (Gene Name=HOXB13)

[Back to BioLiP]