Structure of PDB 4ioa Chain J Binding Site BS02

Receptor Information
>4ioa Chain J (length=136) Species: 1299 (Deinococcus radiodurans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRTKFRKQFRGRMTGDAKGGDYVAFGDYGLIAMEPAWIKSNQIEACRIVM
SRHFRRGGKIYIRIFPDKPVTKKPAETRMGKGKGAVEYWVSVVKPGRVMF
EVAGVTEEQAKEAFRLAGHKLPIQTKMVKREVYDEA
Ligand information
>4ioa Chain Y (length=122) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cacccccgugcccauagcacuguggaaccaccccaccccaugccgaacug
ggucgugaaacacagcagcgccaaugauacucggaccgcagggucccgga
aaagucggucagcgcggggguu
.<<<<<<<<<<.....<<.<<<<<....<<<<<<<.............>>
>>..>>>...>>>>>..>><<<.......<<.<<<<<....>>>>>.>>.
......>>>..>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ioa Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		T19 K99
Binding residue
(residue number reindexed from 1)		T14 K94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ioa, PDBe:4ioa, PDBj:4ioa
PDBsum4ioa
PubMed23414806
UniProtQ9RXJ5|RL16_DEIRA Large ribosomal subunit protein uL16 (Gene Name=rplP)

[Back to BioLiP]