Structure of PDB 3p57 Chain J Binding Site BS02

Receptor Information
>3p57 Chain J (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSS
NKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3p57 Structure of p300 bound to MEF2 on DNA reveals a mechanism of enhanceosome assembly.
Resolution2.1921 Å
Binding residue
(original residue number in PDB)		G2 R3 K5 K31
Binding residue
(residue number reindexed from 1)		G1 R2 K4 K30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0046983 protein dimerization activity
Biological Process
GO:0045944 positive regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3p57, PDBe:3p57, PDBj:3p57
PDBsum3p57
PubMed21278418
UniProtQ02078|MEF2A_HUMAN Myocyte-specific enhancer factor 2A (Gene Name=MEF2A)

[Back to BioLiP]