Structure of PDB 3kov Chain J Binding Site BS02

Receptor Information
>3kov Chain J (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSS
NKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3kov Structure of the MADS-box/MEF2 Domain of MEF2A Bound to DNA and Its Implication for Myocardin Recruitment.
Resolution2.9 Å
Binding residue
(original residue number in PDB)
G2 R3
Binding residue
(residue number reindexed from 1)
G1 R2
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0046983 protein dimerization activity
Biological Process
GO:0045944 positive regulation of transcription by RNA polymerase II

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:3kov, PDBe:3kov, PDBj:3kov
PDBsum3kov
PubMed20132824
UniProtQ02078|MEF2A_HUMAN Myocyte-specific enhancer factor 2A (Gene Name=MEF2A)

[Back to BioLiP]