Structure of PDB 2om1 Chain J Binding Site BS02

Receptor Information
>2om1 Chain J (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Ligand information
>2om1 Chain D (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2om1 Crystallographic characterization of two novel crystal forms of human insulin induced by chaotropic agents and a shift in pH.
Resolution1.97 Å
Binding residue
(original residue number in PDB)		E13 L17
Binding residue
(residue number reindexed from 1)		E13 L17
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2om1, PDBe:2om1, PDBj:2om1
PDBsum2om1
PubMed18093308
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]