Structure of PDB 2a07 Chain J Binding Site BS02

Receptor Information
>2a07 Chain J (length=83) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVRPPFTYATLIRQAIMESSDRQLTLNEIYSWFTRTFAYFRRNAATWKNA
VRHNLSLHKCFVRVENVKGAVWTVDEVEYQKRR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2a07 Structure of the Forkhead Domain of FOXP2 Bound to DNA.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		L527 R553 H554 S557 R564 W573
Binding residue
(residue number reindexed from 1)		L26 R52 H53 S56 R63 W72
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2a07, PDBe:2a07, PDBj:2a07
PDBsum2a07
PubMed16407075
UniProtO15409|FOXP2_HUMAN Forkhead box protein P2 (Gene Name=FOXP2)

[Back to BioLiP]