Structure of PDB 1mow Chain J Binding Site BS02

Receptor Information
>1mow Chain J (length=234) Species: 2275,3055 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NVSGISAYLLGLIWGDGGLYKLKYNRSEYRVVTQKSENLIKQFIAPRMQF
LIDELNVSKIQIVKDTRYELRVSSKKLYYYFANMLERIRLFNGNRFLAYL
AGIVDGDGSIIAQIKPNQSYKFKHQLSLTFQVTQKRRWFVDEIGVGYVRD
RGSVSDYILSEIKPLHNFLTQLQPFLNFKQKQANLVLKIIEQLPAKESPD
KFLEVCTWVDQIAALNDSKTRTTSETVRAVLDSL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1mow Design, Activity and Structure of a Highly Specific Artificial Endonuclease
Resolution2.4 Å
Binding residue
(original residue number in PDB)		N1532 S1534 S1567 K1568 S1583 S1584 K1585 G1616 D1617 G1618 S1619 T1643 Q1644 K1645 A1730 N1733 D1734 S1735 R1738
Binding residue
(residue number reindexed from 1)		N25 S27 S58 K59 S73 S74 K75 G106 D107 G108 S109 T133 Q134 K135 A213 N216 D217 S218 R221
Enzymatic activity
Catalytic site (original residue number in PDB) G1616 D1617
Catalytic site (residue number reindexed from 1) G106 D107
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1mow, PDBe:1mow, PDBj:1mow
PDBsum1mow
PubMed12419232
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI;
P21505|DMO1_DESMO Homing endonuclease I-DmoI

[Back to BioLiP]