Structure of PDB 6hcf Chain I3 Binding Site BS02

Receptor Information

>6hcf Chain I3 (length=205) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGH
MVSDEYEQLSSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINK
MLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVVEALRRAKFKF
PGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGCGVKYIPNRGPLDKW
RALHS

Ligand information

>6hcf Chain 72 (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gucuacggccauaccacccugaacgcgcccgaucucgucugaucucggaa
gcuaagcagggucgggccugguuaguacuuggaugggagaccgccuggga
auaccgggugcuguaggcuu

....<.<<.....<<<<<<<<.....<<<<<..............>>>..
>>....>>>>>>.>><<<<<<<......<.<<..<<....>>.>>.>...
..>>>>>>>.>>.>......

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6hcf ZNF598 Is a Quality Control Sensor of Collided Ribosomes.
Resolution	3.9 Å
Binding residue (original residue number in PDB)	Y11 E56 R203 G204 P205 L206
Binding residue (residue number reindexed from 1)	Y10 E55 R194 G195 P196 L197

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation
GO:0006417	regulation of translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6hcf, PDBe:6hcf, PDBj:6hcf
PDBsum	6hcf
PubMed	30293783
UniProt	B7NZQ2\|RL10_RABIT Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]