Structure of PDB 7oya Chain I1 Binding Site BS02

Receptor Information
>7oya Chain I1 (length=201) Species: 7955 (Danio rerio) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKAKVDEFPLCAHM
VSDEYEQLSSEALEAARICANKYMVKTCGKDGFHIRVRLHPFHVIRINKM
LGMRGAFGKPQGTVARVHIGQVIMSVRTKAQNKEHVIEALRRAKFKFPGR
QKIHVSKKYGFTKFNTCDFDNMLAEKRLIPDGCGVKYIPSRGPLSRWKAL
H
Ligand information
>7oya Chain 71 (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcuuacggccauaccacccuggaaaugcccgaucucaucugaacucggaa
guaaagcagggucgggccugguuaguacuuggaugggagaccgccuggga
auaccaggugcuguaagcua
<<<<<<<<<....<<<<<<<<.....<<<<<..............>>>..
>>....>>>>>>.>><<<<<<<.....<<.<<..<<....>>.>>.>>..
..>>>>>>>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7oya A molecular network of conserved factors keeps ribosomes dormant in the egg.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		Y11 E56 Y57 I131 Y199 S202 R203 G204 P205 L206
Binding residue
(residue number reindexed from 1)		Y9 E54 Y55 I119 Y187 S190 R191 G192 P193 L194
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0045182 translation regulator activity
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
GO:0006417 regulation of translation
GO:0007420 brain development
GO:1990403 embryonic brain development
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oya, PDBe:7oya, PDBj:7oya
PDBsum7oya
PubMed36653451
UniProtQ7ZV96|RL10_DANRE Large ribosomal subunit protein uL16 (Gene Name=rpl10)

[Back to BioLiP]