Structure of PDB 9bvd Chain I Binding Site BS02

Receptor Information
>9bvd Chain I (length=72) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFF
QEAQKLQAMHREKYPNYKYRPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9bvd Role of nucleobase-specific interactions in binding and bending of DNA by human male sex-determination factor SRY.
Resolution2.48 Å
Binding residue
(original residue number in PDB)		K6 R7 I13 R17 R20 N32 Y74 P76 R77
Binding residue
(residue number reindexed from 1)		K1 R2 I8 R12 R15 N27 Y69 P71 R72
External links
PDB RCSB:9bvd, PDBe:9bvd, PDBj:9bvd
PDBsum9bvd
PubMed39168182
UniProtQ05066|SRY_HUMAN Sex-determining region Y protein (Gene Name=SRY)

[Back to BioLiP]