Structure of PDB 8axk Chain I Binding Site BS02

Receptor Information
>8axk Chain I (length=63) Species: 623 (Shigella flexneri) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSDIVYMGNKALYLILIFSLWPVGIPFGIKLIGVSISLLLLSGWYGEVLL
SFCHEIMFLIKSG
Ligand information
>8axk Chain g0 (length=17) Species: 623 (Shigella flexneri) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FPTDSLVSSPRAEKARL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8axk Integrative structural analysis of the type III secretion system needle complex from Shigella flexneri.
Resolution4.05 Å
Binding residue
(original residue number in PDB)		Y6 Y13
Binding residue
(residue number reindexed from 1)		Y6 Y13
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0009306 protein secretion
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8axk, PDBe:8axk, PDBj:8axk
PDBsum8axk
PubMed36790757
UniProtP0A1M4|SPAQ_SHIFL Surface presentation of antigens protein SpaQ (Gene Name=spaQ)

[Back to BioLiP]