Structure of PDB 7zyv Chain I Binding Site BS02

Receptor Information
>7zyv Chain I (length=214) Species: 3562 (Spinacia oleracea) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATG
FAMTFYYRPTVTDAFASVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHV
FRVYLTGGFKKPRELTWVTGVVLGVLTASFGVTGYSLPWDQIGYWAVKIV
TGVPDAIPVIGSPLVELLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLM
HFLMIRKQGISGPL
Ligand information
>7zyv Chain R (length=26) Species: 3562 (Spinacia oleracea) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KSFVDWLLGKITKEDQFYETDPILRG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zyv High-resolution cryo-EM structures of plant cytochrome b 6 f at work.
Resolution2.13 Å
Binding residue
(original residue number in PDB)		P28 L215
Binding residue
(residue number reindexed from 1)		P27 L214
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0016491 oxidoreductase activity
GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity
GO:0046872 metal ion binding
Biological Process
GO:0015979 photosynthesis
GO:0022904 respiratory electron transport chain
Cellular Component
GO:0009507 chloroplast
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zyv, PDBe:7zyv, PDBj:7zyv
PDBsum7zyv
PubMed36638176
UniProtP00165|CYB6_SPIOL Cytochrome b6 (Gene Name=petB)

[Back to BioLiP]